Key words: Open-omics-alphaFold, AlphaFold2, AlphaFold2 on CPU, AlphaFold2 on Xeon, AlphaFold2 inference on SPR AVX512 FP32 and AMX-BF16
This repository contains an inference pipeline of AlphaFold2 with a bona fide translation from Haiku/JAX (https://github.com/deepmind/alphafold) to PyTorch.
Declaration 1 Any publication that discloses findings arising from using this source code or the model parameters should cite the AlphaFold paper. Please also refer to the Supplementary Information for a detailed description of the method.
Declaration 2 The setup procedures were modified from the two repos: https://github.com/kalininalab/alphafold_non_docker https://github.com/deepmind/alphafold with only some exceptions. I will label the difference for highlight.
Declaration 3 This repo is independently implemented, and is different from a previously unofficial version (https://github.com/lucidrains/alphafold2). No one is better than the other, and the differences are in 3 points: (1) this repo is major in acceleration of inference, in compatible to weights released from DeepMind; (2) this repo delivers a reliable pipeline accelerated on Intel® Core/Xeon and Intel® Optane® PMem by Intel® oneAPI. (3) this repo places CPU as its primary computation resource for acceleration, which may not provide an optimal speed on GPU.
-
Install miniforge;
wget "https://github.com/conda-forge/miniforge/releases/latest/download/Miniforge3-$(uname)-$(uname -m).sh" bash Miniforge3-$(uname)-$(uname -m).sh
-
create conda environment using a .yml file:
conda env create -f conda_requirements.yml conda activate iaf2
-
update submodules
git submodule update --init --recursive
-
Build dependencies for preprocessing (Optimized hh-suite and hmmer):
build AVX512-optimized hh-suite
export IAF2_DIR=`pwd` git clone --recursive https://github.com/IntelLabs/hh-suite.git cd hh-suite mkdir build && cd build cmake -DCMAKE_INSTALL_PREFIX=`pwd`/release -DCMAKE_CXX_COMPILER="icpx" -DCMAKE_CXX_FLAGS_RELEASE="-O3 -march=native" .. make -j 4 && make install ./release/bin/hhblits -h export PATH=`pwd`/release/bin:$PATH cd $IAF2_DIR
build AVX512-optimized hmmer
export IAF2_DIR=`pwd` git clone --recursive https://github.com/IntelLabs/hmmer.git cd hmmer cp easel_makefile.in easel/Makefile.in cd easel && make clean && autoconf && ./configure --prefix=`pwd` && cd .. autoconf && CC=icx CFLAGS="-O3 -march=native -fPIC" ./configure --prefix=`pwd`/release make -j 4 && make install ./release/bin/jackhmmer -h export PATH=`pwd`/release/bin:$PATH cd $IAF2_DIR
-
Install jemalloc
git clone --branch 5.3.0 https://github.com/jemalloc/jemalloc.git cd jemalloc && bash autogen.sh --prefix=$CONDA_PREFIX && make install cd .. export LD_LIBRARY_PATH="$CONDA_PREFIX/lib:$LD_LIBRARY_PATH"
-
build dependency for TPP optimization of AlphaFold2 [Global]Attention Modules:
TPP-pytorch-extension implements efficient kernels for Xeon CPUs in C++ using the libxsmm library. If setup failed, AlphaFold2 will fall back to enable PyTorch JIT w/o PCL-extension. (Use gcc > 11.4.0)
export IAF2_DIR=`pwd` git clone https://github.com/libxsmm/tpp-pytorch-extension cd tpp-pytorch-extension git submodule update --init CC=gcc CXX=g++ python setup.py install python -c "from tpp_pytorch_extension.alphafold.Alpha_Attention import GatingAttentionOpti_forward"
-
extract weights in the <root_home> directory
mkdir weights && mkdir weights/extracted python extract_params.py --input <data-dir>/params/params_model_1.npz --output_dir ./weights/extracted/model_1
For Multimer,
python extract_params.py --input <data-dir>/params/model_1_multimer_v3.npz --output_dir ./weights/extracted/model_1_multimer_v3
-
Put your query sequence files in "<input-dir>" folder:
all fasta sequences should be named as *.fa 1 sequence per each file, e.g. example.fa
> example file ATGCCGCATGGTCGTCFor Multimer, remember to put each chain separately in the fasta file, even when the chains are identical. The following file shows two identical chains in a multimer fasta file.
>6E3K_1|Chains A|Interferon gamma|Homo sapiens (9606) GPGSQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQAAAHHHHHHHH >6E3K_1|Chains B|Interferon gamma|Homo sapiens (9606) GPGSQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQAAAHHHHHHHH -
run main scripts to test your env
run preprocess main script to do MSA and template search on 1st sample in $root_home/samples
bash online_preproc_monomer.sh <root_home> <data-dir> <input-dir> <output-dir> # please ensure your query sequence files *.fa are in <input-dir>
For Multimer,
bash online_preproc_multimer.sh <root_home> <data-dir> <input-dir> <output-dir>
intermediates data can be seen under $output-dir//intermediates and $output-dir//msa
run model inference script to predict unrelaxed structures from MSA and template results
bash online_inference_monomer.sh <conda_env_path> <root_home> <input-dir> <output-dir> <model_names>
For Multimer,
bash online_inference_multimer.sh <conda_env_path> <root_home> <input-dir> <output-dir> <model_names>
By default, inference runs in bfloat16 precision. Set AF2_BF16 input to 0 to run in FP32 precision. unrelaxed data can be seen under $output-dir/
-
Run relaxation script (Untested)
Download stereo_chemical_props.txt file into alphafold/common folder using the following command
wget -q -P ./alphafold/common/ https://git.scicore.unibas.ch/schwede/openstructure/-/raw/7102c63615b64735c4941278d92b554ec94415f8/modules/mol/alg/src/stereo_chemical_props.txt --no-check-certificate
Run the relaxation script with the following command
bash one_amber.sh <root_home> <input-dir> <output-dir> <model_names> monomer
For Multimer,
bash one_amber.sh <root_home> <input-dir> <output-dir> <model_names> multimer <num_multimer_predictions_per_model>
-
Multi-instance Throughput Run First, create a logs directory in the <root_home> directory with the following command
mkdir <root_home>/logs
Run the multi-instance preprocessing script with the following command
python run_multiprocess_pre.py --root_home=<root_home> --data_dir=<data_dir> --input_dir=<input_dir> --output_dir=<output_dir> --model_name=<model_name>
For Multimer,
python run_multiprocess_pre_multimer.py --root_home=<root_home> --data_dir=<data_dir> --input_dir=<input_dir> --output_dir=<output_dir>
Set library paths correctly export LD_LIBRARY_PATH=$CONDA_PREFIX/lib:$LD_LIBRARY_PATH export LD_PRELOAD=$CONDA_PREFIX/lib/libjemalloc.so:$LD_PRELOAD Run the multi-instance model inference script with the following command
python run_multiprocess_infer.py --root_home=<root_home> --input_dir=<input_dir> --output_dir=<output_dir> --model_names=<model_names>
For Multimer,
python run_multiprocess_infer_multimer.py --root_home=<root_home> --input_dir=<input_dir> --output_dir=<output_dir> --model_names=<model_names>
For multiprocess relaxation,
python run_multiprocess_relax.py --root_home=<root_home> --input_dir=<input_dir> --output_dir=<output_dir> --model_names=<model_names> --model_preset=monomer # or multimer
- Update is on schedule: AlphaFold with Multimers will be coming soon
Please use the AlphaFold2 database download instructions from the original repo. (https://github.com/google-deepmind/alphafold?tab=readme-ov-file#genetic-databases)
While the AlphaFold code is licensed under the Apache 2.0 License, the AlphaFold parameters are made available for non-commercial use only under the terms of the CC BY-NC 4.0 license. Please see the Disclaimer below for more detail.
Please follow instructions from the original AlphaFold2 repo. https://github.com/google-deepmind/alphafold?tab=readme-ov-file#model-parameters
Recommended server configuration
- CPU: 2-sockets, Intel® Xeon® Scalable Performance Processor (61xx, 81xx, 62xx, 82xx, 92xx, 63xx, 83xx, etc.)
- Memory: DRAM >192GB, or Intel® Optane® Persistent Memory (PMem) for higher Memory (e.g. 6TB/socket)
- Disk: Intel® Optane® SSD
We need to extract the original model parameters into directory tree, so that PyTorch version of Alphafold2 can easily load params w/o mistakes. Please use extract_params.py to execute such convertion.
The outputs will be in a subfolder of output_dir in run_docker.py. They
include the computed MSAs, unrelaxed structures, relaxed structures, ranked
structures, raw model outputs, prediction metadata, and section timings. The
output_dir directory will have the following structure:
<target_name>/
features.pkl
ranked_{0,1,2,3,4}.pdb
ranking_debug.json
relaxed_model_{1,2,3,4,5}.pdb
result_model_{1,2,3,4,5}.pkl
timings.json
unrelaxed_model_{1,2,3,4,5}.pdb
msas/
bfd_uniclust_hits.a3m
mgnify_hits.sto
uniref90_hits.sto
intermediates/
features.npz
processed_features.npz
The contents of each output file are as follows:
-
features.pkl– Apicklefile containing the input feature NumPy arrays used by the models to produce the structures. -
unrelaxed_model_*.pdb– A PDB format text file containing the predicted structure, exactly as outputted by the model. -
relaxed_model_*.pdb– A PDB format text file containing the predicted structure, after performing an Amber relaxation procedure on the unrelaxed structure prediction (see Jumper et al. 2021, Suppl. Methods 1.8.6 for details). -
ranked_*.pdb– A PDB format text file containing the relaxed predicted structures, after reordering by model confidence. Hereranked_0.pdbshould contain the prediction with the highest confidence, andranked_4.pdbthe prediction with the lowest confidence. To rank model confidence, we use predicted LDDT (pLDDT) scores (see Jumper et al. 2021, Suppl. Methods 1.9.6 for details). -
ranking_debug.json– A JSON format text file containing the pLDDT values used to perform the model ranking, and a mapping back to the original model names. -
timings.json– A JSON format text file containing the times taken to run each section of the AlphaFold pipeline. -
msas/- A directory containing the files describing the various genetic tool hits that were used to construct the input MSA. -
result_model_*.pkl– Apicklefile containing a nested dictionary of the various NumPy arrays directly produced by the model. In addition to the output of the structure module, this includes auxiliary outputs such as:- Distograms (
distogram/logitscontains a NumPy array of shape [N_res, N_res, N_bins] anddistogram/bin_edgescontains the definition of the bins). - Per-residue pLDDT scores (
plddtcontains a NumPy array of shape [N_res] with the range of possible values from0to100, where100means most confident). This can serve to identify sequence regions predicted with high confidence or as an overall per-target confidence score when averaged across residues. - Present only if using pTM models: predicted TM-score (
ptmfield contains a scalar). As a predictor of a global superposition metric, this score is designed to also assess whether the model is confident in the overall domain packing. - Present only if using pTM models: predicted pairwise aligned errors
(
predicted_aligned_errorcontains a NumPy array of shape [N_res, N_res] with the range of possible values from0tomax_predicted_aligned_error, where0means most confident). This can serve for a visualisation of domain packing confidence within the structure.
- Distograms (
The pLDDT confidence measure is stored in the B-factor field of the output PDB files (although unlike a B-factor, higher pLDDT is better, so care must be taken when using for tasks such as molecular replacement).
This code has been tested to match mean top-1 accuracy on a CASP14 test set with pLDDT ranking over 5 model predictions (some CASP targets were run with earlier versions of AlphaFold and some had manual interventions; see our forthcoming publication for details). Some targets such as T1064 may also have high individual run variance over random seeds.
If you use the code or data in this package, please cite:
@Article{AlphaFold2021,
author = {Jumper, John and Evans, Richard and Pritzel, Alexander and Green, Tim and Figurnov, Michael and Ronneberger, Olaf and Tunyasuvunakool, Kathryn and Bates, Russ and {\v{Z}}{\'\i}dek, Augustin and Potapenko, Anna and Bridgland, Alex and Meyer, Clemens and Kohl, Simon A A and Ballard, Andrew J and Cowie, Andrew and Romera-Paredes, Bernardino and Nikolov, Stanislav and Jain, Rishub and Adler, Jonas and Back, Trevor and Petersen, Stig and Reiman, David and Clancy, Ellen and Zielinski, Michal and Steinegger, Martin and Pacholska, Michalina and Berghammer, Tamas and Bodenstein, Sebastian and Silver, David and Vinyals, Oriol and Senior, Andrew W and Kavukcuoglu, Koray and Kohli, Pushmeet and Hassabis, Demis},
journal = {Nature},
title = {Highly accurate protein structure prediction with {AlphaFold}},
year = {2021},
doi = {10.1038/s41586-021-03819-2},
note = {(Accelerated article preview)},
}Colab notebooks provided by the community (please note that these notebooks may vary from our full AlphaFold system and we did not validate their accuracy):
- The ColabFold AlphaFold2 notebook by Martin Steinegger, Sergey Ovchinnikov and Milot Mirdita, which uses an API hosted at the Södinglab based on the MMseqs2 server (Mirdita et al. 2019, Bioinformatics) for the multiple sequence alignment creation.
AlphaFold communicates with and/or references the following separate libraries and packages:
- Abseil
- Biopython
- Chex
- Colab
- Docker
- HH Suite
- HMMER Suite
- Haiku
- Immutabledict
- JAX
- Kalign
- matplotlib
- ML Collections
- NumPy
- OpenMM
- OpenStructure
- pymol3d
- SciPy
- Sonnet
- TensorFlow
- Tree
- tqdm
We thank all their contributors and maintainers!
This is not an officially supported Google product.
Copyright 2021 DeepMind Technologies Limited.
Licensed under the Apache License, Version 2.0 (the "License"); you may not use this file except in compliance with the License. You may obtain a copy of the License at https://www.apache.org/licenses/LICENSE-2.0.
Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an "AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License.
The AlphaFold parameters are made available for non-commercial use only, under the terms of the Creative Commons Attribution-NonCommercial 4.0 International (CC BY-NC 4.0) license. You can find details at: https://creativecommons.org/licenses/by-nc/4.0/legalcode
Use of the third-party software, libraries or code referred to in the Acknowledgements section above may be governed by separate terms and conditions or license provisions. Your use of the third-party software, libraries or code is subject to any such terms and you should check that you can comply with any applicable restrictions or terms and conditions before use.
The following databases have been mirrored by DeepMind, and are available with reference to the following:
-
BFD (unmodified), by Steinegger M. and Söding J., available under a Creative Commons Attribution-ShareAlike 4.0 International License.
-
BFD (modified), by Steinegger M. and Söding J., modified by DeepMind, available under a Creative Commons Attribution-ShareAlike 4.0 International License. See the Methods section of the AlphaFold proteome paper for details.
-
Uniclust30: v2018_08 (unmodified), by Mirdita M. et al., available under a Creative Commons Attribution-ShareAlike 4.0 International License.
-
MGnify: v2018_12 (unmodified), by Mitchell AL et al., available free of all copyright restrictions and made fully and freely available for both non-commercial and commercial use under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.